Cleavage with chymotrypsin yields the following peptide frag

Cleavage with chymotrypsin yields the following peptide fragments: F Y DPTKM LACGVRGF RTTGHLCGKDLVNALY Cleavage with Staphylococcus aureus V8 protease produces the following fragments: PTKM RTTGHLCGKD LVNALYIACGVRGFFYD

Solution

Answer:

2. The sequence of the full peptide fragment can be calculated as under:

We need to combine the cleaved fragments from both the enzymes and arrange them in an overlapping fashion.

Chymotrypsin cleavage: Phe, Tyr, Trp (Carboxy end)

Staphylococcus aureus V8: Glu and Asp (Carboxy end)

RTTGHLCGKDLVNALYIACGVRGFFYDPTKM