Thanks Calculate the Molar Extinction Coefficient and mgmL E

Thanks!

Calculate the Molar Extinction Coefficient, and mg/mL Extinction Coefficient for a protein C both under fully reduced and fully oxidized conditions using the equation to calculate extinction coefficients. The A_280 of protein C after diluting 50 mu L of the original stock to 1000 mu L is 0.65. Calculate the concentration in mg/mL of the original protein stock that is under fully reduced condition. Assume a 1 cm path length. The molecular weight of the protein is 11716 Da. Sequence of protein C MTAHYILRSTAEAEAWLRGIIRYTRREARRMDRYIAKLELCEMDLAGPFKWMSEGAALYPAL RMARCEHHYVRGADLPAGEPALWVVAILHGEQVELCTRLADRLKG

Solution

ans. As we know the molar extinction coefficient can be calculated by following formulae

Absorbance = molar extinction coeffiecient x conc x path length

.65 = molar extinction coefficient x 1000 x 1 cm

molar extinction coefficient = .65/1000

molar extinction coefficient = 6.5 x 10⁴