You sequence a new organism and identify the gene sequence b
Solution
The sequence \"DKERLLELLKLPRQLWGDFGRMQQAYKQQSLLLHPDKGGSHALMQELNSLWGTFKTEVYNL\" was queried in NCBI blastp. The output showed 100% query coverage (match) with \"N-Terminal J Domain Of Murine Polyomavirus T Antigen (Id 1FAF_A)\" with an expect value of 10-36 (very strong match).
The same sequence was also queried in NCBI CDD to find conserved domains. Two overlapping domains, namely, DnaJ molecular chaperone homology domain (smart00271) and Small T antigen (PHA03102) could be identified. DnaJ domain is associated with heat shock protein (HSP40) and plays important roles in protein translation, folding, unfolding, translocation, and degradation. Small T antigen (PHA03102) domain is a model domain that spans several domains. Gene ontology terms were inferred from the domain\'s BioSystems link-out to GO terms; most likely terms to be associated with the protein are \"binding\", \"protein binding\", and \"molecular function\".

