You sequence a new organism and identify the gene sequence b

You sequence a new organism and identify the gene sequence below but have no idea what its function is. Use at least two publicly available web tools to predict the function of the gene product below. What does it match to, and how well does it match? Are there any conserved domains? What do those domains do? Specifically please note the most likely Gene Ontology terms that would be assigned to this protein. Describe your procedure and interpret your results. >Unknown protein DKERLLELLKLPRQLWGDFGRMQQAYKQQSLLLHPDKGGSHALMQELNSLWGTFKTEVYNL

Solution

The sequence \"DKERLLELLKLPRQLWGDFGRMQQAYKQQSLLLHPDKGGSHALMQELNSLWGTFKTEVYNL\" was queried in NCBI blastp. The output showed 100% query coverage (match) with \"N-Terminal J Domain Of Murine Polyomavirus T Antigen (Id 1FAF_A)\" with an expect value of 10^-36 (very strong match).

The same sequence was also queried in NCBI CDD to find conserved domains. Two overlapping domains, namely, DnaJ molecular chaperone homology domain (smart00271) and Small T antigen (PHA03102) could be identified. DnaJ domain is associated with heat shock protein (HSP40) and plays important roles in protein translation, folding, unfolding, translocation, and degradation. Small T antigen (PHA03102) domain is a model domain that spans several domains. Gene ontology terms were inferred from the domain\'s BioSystems link-out to GO terms; most likely terms to be associated with the protein are \"binding\", \"protein binding\", and \"molecular function\".