Calculate the Molar Extinction Coefficient and mgmL Extincti
Calculate the Molar Extinction Coefficient, and mg/mL Extinction Coefficient for a protein C both under fully reduced and fully oxidized conditions using the equation to calculate extinction coefficients. The A280 of protein C after diluting 50 L of the original stock to 1000 L is 0.65. Calculate the concentration in mg / mL of the original protein stock that is under fully reduced condition. Assume a 1 cm path length. The molecular weight of the protein is 11716 Da.
Sequence of protein C:
MTAHYILRSTAEAEAWLRGIIRYTRREARRMDRYIAKLELCEMDLAGPFKWMSEGAALYPAL RMARCEHHYVRGADLPAGEPALWVVAILHGEQVELCTRLADRLKG
Solution
For the above mentioned sequence--- The total number of residues are 107, molecular weight- 12285g/mol
the number of individual residues are-as followes: Ala-16, Glu- 10, Ile-5, Asn-0, Ser-2, Tyr-5, Asn-0, Phe-1,Lys-3, Pro-4, The-4, Gln-0, Cys-3,Gly-7, Leu-13,Gln-1,Val-4, Asp-4,His-4,Met-5, Arg-13, Trp-3
based upon the above data Extinction Coefficient for scared protein : 24138 cm-1 M-1
Extinction Coefficient for cytosolic protein : 23950cm-1 M-1

